ZNF414 Antibody
| Name | ZNF414 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33693 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGGAGGMQQGSSPAPDSCQPGPGPSPGLTSIVSGTSEDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF414 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF414 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: ZNF414 Antibody [NBP2-33693] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7183_ZNF414-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33693-img0004.jpg)
![Immunohistochemistry: ZNF414 Antibody [NBP2-33693] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7184_ZNF414-Antibody-Immunohistochemistry-NBP2-33693-img0001.jpg)