SHISA9 Antibody
| Name | SHISA9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33678 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LEKAHRPQREHMSRALADVMRPQGHCNTDHMERDLNIVVHVQHYENMDTRTPINNLHATQMNNAVPTSPLLQQMGHPHS |
| Description | Rabbit Polyclonal |
| Gene | SHISA9 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SHISA9 Antibody [NBP2-33678] - prostate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24783_SHISA9-Antibody-Immunohistochemistry-NBP2-33678-img0002.jpg)
Immunohistochemistry: SHISA9 Antibody [NBP2-33678] - prostate
![Immunohistochemistry: SHISA9 Antibody [NBP2-33678] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24784_SHISA9-Antibody-Immunohistochemistry-NBP2-33678-img0001.jpg)
Immunohistochemistry: SHISA9 Antibody [NBP2-33678] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
![Immunohistochemistry-Paraffin: SHISA9 Antibody [NBP2-33678] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24785_SHISA9%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33678-img0003.jpg)
Immunohistochemistry-Paraffin: SHISA9 Antibody [NBP2-33678] - liver cancer