PHF10 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33759
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PHF10 Protein
• Description: Rabbit Polyclonal
• Gene: PHF10
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: PHF10 Antibody [NBP2-33759] - Immunofluorescent staining of human cell line HeLa shows localization to nucleus.

Immunohistochemistry-Paraffin: PHF10 Antibody [NBP2-33759] - Staining of liver cancer.

Immunohistochemistry-Paraffin: PHF10 Antibody [NBP2-33759] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PHF10 Antibody [NBP2-33759] - Staining of liver.