TM6SF1 Antibody
| Name | TM6SF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91091 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PGCSWMPDITLIHAGGLAQAQFSHIGASLHARTAYVYRVPEEAK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TM6SF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TM6SF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TM6SF1 Antibody [NBP1-91091] - Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22603_TM6SF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91091-img0006.jpg)
Immunocytochemistry/Immunofluorescence: TM6SF1 Antibody [NBP1-91091] - Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments.
![Immunohistochemistry-Paraffin: TM6SF1 Antibody [NBP1-91091] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22604_TM6SF1-Antibody-Immunohistochemistry-Paraffin-NBP1-91091-img0005.jpg)
Immunohistochemistry-Paraffin: TM6SF1 Antibody [NBP1-91091] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.