SH2D5 Antibody
| Name | SH2D5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91024 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPWSWKPGTLGAMQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPRRRAVILKFSLQGLKIYSG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SH2D5 Protein |
| Description | Rabbit Polyclonal |
| Gene | SH2D5 |
| Supplier Page | Shop |
![Immunocytochemistry/ Immunofluorescence: SH2D5 Antibody [NBP1-91024] - Staining of human cell line A-431 shows positivity in cytoplasm & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3625_SH2D5-Antibody-Immunocytochemistry--Immunofluorescence-NBP1-91024-img0004.jpg)
![Immunohistochemistry-Paraffin: SH2D5 Antibody [NBP1-91024] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3626_SH2D5-Antibody-Immunohistochemistry-Paraffin-NBP1-91024-img0005.jpg)