CLRN2 Antibody
| Name | CLRN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90967 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VKFHDLTERIANFQEKLFQFVVVEEQYEES |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CLRN2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CLRN2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CLRN2 Antibody [NBP1-90967] - Staining of human cell line U-251 MG shows positivity in cytoplasm & cytoskeleton (intermediate filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3642_CLRN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90967-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CLRN2 Antibody [NBP1-90967] - Staining of human cell line U-251 MG shows positivity in cytoplasm & cytoskeleton (intermediate filaments).
![Immunohistochemistry-Paraffin: CLRN2 Antibody [NBP1-90967] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/3643_CLRN2-Antibody-Immunohistochemistry-Paraffin-NBP1-90967-img0005.jpg)
Immunohistochemistry-Paraffin: CLRN2 Antibody [NBP1-90967] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.