C9orf117 Antibody
| Name | C9orf117 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90934 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf117 Protein |
| Description | Rabbit Polyclonal |
| Gene | C9orf117 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C9orf117 Antibody [NBP1-90934] - Staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24976_C9orf117%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90934-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C9orf117 Antibody [NBP1-90934] - Staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
![Immunohistochemistry-Paraffin: C9orf117 Antibody [NBP1-90934] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24977_C9orf117%2520Antibody-Immunohistochemistry-Paraffin-NBP1-90934-img0002.jpg)
Immunohistochemistry-Paraffin: C9orf117 Antibody [NBP1-90934] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.