LRRC14B Antibody
| Name | LRRC14B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90992 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LRCIEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETSNELGAFLLQAFKTAL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC14B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRRC14B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: LRRC14B Antibody [NBP1-90992] - Staining of human cell line A-431 shows positivity in nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5568_LRRC14B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90992-img0003.jpg)
![Immunohistochemistry-Paraffin: LRRC14B Antibody [NBP1-90992] - Staining of human bronchus shows moderate cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5569_LRRC14B%2520Antibody-Immunohistochemistry-Paraffin-NBP1-90992-img0002.jpg)