C6orf58 Antibody
| Name | C6orf58 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91000 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GTSNLSETEPPLWKESPGQLSDYRVENSMYIINPWVYLERMGMYKIILNQTARYFAKFAPDNEQNILWGLPLQYGWQYRTGRLADPTRR |
| Description | Rabbit Polyclonal |
| Gene | C6orf58 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C6orf58 Antibody [NBP1-91000] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25034_C6orf58%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91000-img0003.jpg)
Immunocytochemistry/Immunofluorescence: C6orf58 Antibody [NBP1-91000] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: C6orf58 Antibody [NBP1-91000] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25035_C6orf58%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91000-img0002.jpg)
Immunohistochemistry-Paraffin: C6orf58 Antibody [NBP1-91000] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.