FAM155A Antibody
| Name | FAM155A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90982 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM155A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM155A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM155A Antibody [NBP1-90982] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14013_FAM155A%2520Antibody-Western%2520Blot-NBP1-90982-img0004.jpg)
Western Blot: FAM155A Antibody [NBP1-90982] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
![Immunocytochemistry/Immunofluorescence: FAM155A Antibody [NBP1-90982] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14014_FAM155A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90982-img0003.jpg)
Immunocytochemistry/Immunofluorescence: FAM155A Antibody [NBP1-90982] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14015_FAM155A-Antibody-Immunohistochemistry-Paraffin-NBP1-90982-img0002.jpg)
Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.