DBX1 Antibody
| Name | DBX1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90978 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DBX1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DBX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: DBX1 Antibody [NBP1-90978] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4016_DBX1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90978-img0003.jpg)
![Immunohistochemistry-Paraffin: DBX1 Antibody [NBP1-90978] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4017_DBX1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-90978-img0002.jpg)