TZFP Antibody
| Name | TZFP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33659 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PTTGAWQEVWREQRIPLSLNAPKGLWSQNQLASSSPTPGSLPQGPAQLSPGEMEESDQGHTGALATCAGHEDKAGCP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TZFP Protein |
| Description | Rabbit Polyclonal |
| Gene | ZBTB32 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-33659] - adrenal gland](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25058_TZFP-Antibody-Immunohistochemistry-Paraffin-NBP2-33659-img0002.jpg)
Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-33659] - adrenal gland
![Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-33659] - Immunohistochemical staining of human adrenal gland shows moderate nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25059_TZFP-Antibody-Immunohistochemistry-Paraffin-NBP2-33659-img0001.jpg)
Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-33659] - Immunohistochemical staining of human adrenal gland shows moderate nuclear positivity in glandular cells.
![Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-33659] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25060_TZFP%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33659-img0003.jpg)
Immunohistochemistry-Paraffin: TZFP Antibody [NBP2-33659] - liver cancer