ROPN1B Antibody
| Name | ROPN1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33653 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ROPN1B Protein |
| Description | Rabbit Polyclonal |
| Gene | ROPN1B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ROPN1B Antibody [NBP2-33653] - tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25067_ROPN1B-Antibody-Immunohistochemistry-Paraffin-NBP2-33653-img0002.jpg)
Immunohistochemistry-Paraffin: ROPN1B Antibody [NBP2-33653] - tonsil
![Immunohistochemistry-Paraffin: ROPN1B Antibody [NBP2-33653] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25068_ROPN1B-Antibody-Immunohistochemistry-Paraffin-NBP2-33653-img0001.jpg)
Immunohistochemistry-Paraffin: ROPN1B Antibody [NBP2-33653] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
![Immunohistochemistry-Paraffin: ROPN1B Antibody [NBP2-33653] - pancreatic cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25069_ROPN1B%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33653-img0003.jpg)
Immunohistochemistry-Paraffin: ROPN1B Antibody [NBP2-33653] - pancreatic cancer