RNF23 Antibody
| Name | RNF23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33605 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQEYKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF23 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRIM39 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RNF23 Antibody [NBP2-33605] - Staining of human cell line A-431 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11597_RNF23-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33605-img0004.jpg)
![Immunohistochemistry-Paraffin: RNF23 Antibody [NBP2-33605] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11598_RNF23-Antibody-Immunohistochemistry-Paraffin-NBP2-33605-img0001.jpg)