PLAC1L Antibody
| Name | PLAC1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33601 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PLAC1L Protein |
| Description | Rabbit Polyclonal |
| Gene | OOSP2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - placenta](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25092_PLAC1L-Antibody-Immunohistochemistry-Paraffin-NBP2-33601-img0002.jpg)
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - placenta
![Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25093_PLAC1L-Antibody-Immunohistochemistry-Paraffin-NBP2-33601-img0001.jpg)
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in subset of glandular cells.
![Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25094_PLAC1L%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33601-img0003.jpg)
Immunohistochemistry-Paraffin: PLAC1L Antibody [NBP2-33601] - liver cancer