SHISA2 Antibody
| Name | SHISA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33577 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PEGTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHPPYVGYTVQHDSVPMTAVPPFMDGLQPGYRQIQSPFPHTNSEQKMYPAVT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SHISA2 Protein |
| Description | Rabbit Polyclonal |
| Gene | SHISA2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SHISA2 Antibody [NBP2-33577] - cerebellum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25121_SHISA2-Antibody-Immunohistochemistry-NBP2-33577-img0002.jpg)
Immunohistochemistry: SHISA2 Antibody [NBP2-33577] - cerebellum
![Immunohistochemistry: SHISA2 Antibody [NBP2-33577] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in subset of glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25122_SHISA2-Antibody-Immunohistochemistry-NBP2-33577-img0001.jpg)
Immunohistochemistry: SHISA2 Antibody [NBP2-33577] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in subset of glial cells.
![Immunohistochemistry: SHISA2 Antibody [NBP2-33577] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25123_SHISA2%2520Antibody-Immunohistochemistry-NBP2-33577-img0003.jpg)
Immunohistochemistry: SHISA2 Antibody [NBP2-33577] - liver cancer