NOTUM Antibody
| Name | NOTUM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33670 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NOTUM Protein |
| Description | Rabbit Polyclonal |
| Gene | NOTUM |
| Supplier Page | Shop |
Product images
![Western Blot: NOTUM Antibody [NBP2-33670] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25162_NOTUM%2520Antibody-Western%2520Blot-NBP2-33670-img0002.jpg)
Western Blot: NOTUM Antibody [NBP2-33670] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
![Immunohistochemistry: NOTUM Antibody [NBP2-33670] - Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25163_NOTUM-Antibody-Immunohistochemistry-NBP2-33670-img0001.jpg)
Immunohistochemistry: NOTUM Antibody [NBP2-33670] - Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.