LRRC10B Antibody
| Name | LRRC10B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33493 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC10B Protein |
| Description | Rabbit Polyclonal |
| Gene | LRRC10B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: LRRC10B Antibody [NBP2-33493] - Staining of human prostate shows strong positivity with a granular pattern.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29912_LRRC10B-Antibody-Immunohistochemistry-Paraffin-NBP2-33493-img0001.jpg)
Immunohistochemistry-Paraffin: LRRC10B Antibody [NBP2-33493] - Staining of human prostate shows strong positivity with a granular pattern.