NBEAL1 Antibody
| Name | NBEAL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33553 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NBEAL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NBEAL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NBEAL1 Antibody [NBP2-33553] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8817_NBEAL1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33553-img0005.jpg)
Immunocytochemistry/Immunofluorescence: NBEAL1 Antibody [NBP2-33553] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
![Immunohistochemistry: NBEAL1 Antibody [NBP2-33553] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8818_NBEAL1-Antibody-Immunohistochemistry-NBP2-33553-img0001.jpg)
Immunohistochemistry: NBEAL1 Antibody [NBP2-33553] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.