ZER1 Antibody
| Name | ZER1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33525 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LFYLTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTRQDESIQRIAVHLCNALVC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZER1 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZER1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ZER1 Antibody [NBP2-33525] - bronchus](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25323_ZER1-Antibody-Immunohistochemistry-Paraffin-NBP2-33525-img0002.jpg)
Immunohistochemistry-Paraffin: ZER1 Antibody [NBP2-33525] - bronchus
![Immunohistochemistry-Paraffin: ZER1 Antibody [NBP2-33525] - Immunohistochemical staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25324_ZER1-Antibody-Immunohistochemistry-Paraffin-NBP2-33525-img0001.jpg)
Immunohistochemistry-Paraffin: ZER1 Antibody [NBP2-33525] - Immunohistochemical staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.
![Immunohistochemistry-Paraffin: ZER1 Antibody [NBP2-33525] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25325_ZER1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33525-img0003.jpg)
Immunohistochemistry-Paraffin: ZER1 Antibody [NBP2-33525] - liver cancer