RIPK4 Antibody
| Name | RIPK4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89083 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQEITSETEDLCEKPDDEVKETAHDLDVK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RIPK4 Protein |
| Description | Rabbit Polyclonal |
| Gene | RIPK4 |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: RIPK4 Antibody [NBP1-89083] - Staining of human pancreas shows strong positivity in subsets of cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2708_RIPK4-Antibody-Immunohistochemistry-Paraffin-NBP1-89083-img0005.jpg)
![Immunofluorescence: RIPK4 Antibody [NBP1-89083] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2709_RIPK4-Antibody-Immunofluorescence-NBP1-89083-img0004.jpg)