SLC25A31 Antibody
| Name | SLC25A31 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89074 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC25A31 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC25A31 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC25A31 Antibody [NBP1-89074] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24346_SLC25A31%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89074-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC25A31 Antibody [NBP1-89074] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
![Immunohistochemistry-Paraffin: SLC25A31 Antibody [NBP1-89074] - Staining of human cerebellum shows distinct nuclear positivity in purkinje cells and cells in molecular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24347_SLC25A31-Antibody-Immunohistochemistry-Paraffin-NBP1-89074-img0002.jpg)
Immunohistochemistry-Paraffin: SLC25A31 Antibody [NBP1-89074] - Staining of human cerebellum shows distinct nuclear positivity in purkinje cells and cells in molecular layer.