SLC25A24 Antibody
| Name | SLC25A24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89049 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC25A24 Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC25A24 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC25A24 Antibody [NBP1-89049] Staining of human cell line A-431 shows positivity in cytoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25439_SLC25A24%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89049-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC25A24 Antibody [NBP1-89049] Staining of human cell line A-431 shows positivity in cytoplasm & mitochondria.
![Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP1-89049] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25440_SLC25A24%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89049-img0002.jpg)
Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP1-89049] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.