MIS18A Antibody
| Name | MIS18A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88943 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MIS18A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MIS18A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MIS18A Antibody [NBP1-88943] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 High](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5579_MIS18A-Antibody-Western-Blot-NBP1-88943-img0003.jpg)
Western Blot: MIS18A Antibody [NBP1-88943] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 High
![Immunohistochemistry: MIS18A Antibody [NBP1-88943] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. Sertoli cells are generally negative.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5580_MIS18A-Antibody-Immunohistochemistry-NBP1-88943-img0002.jpg)
Immunohistochemistry: MIS18A Antibody [NBP1-88943] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. Sertoli cells are generally negative.
![Simple Western: MIS18A Antibody [NBP1-88943] - Simple Western lane view shows a specific band for MIS18A in 0.2 mg/ml of Ntera-2 (left) and h. Testis (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5581_MIS18A-Antibody-Simple-Western-NBP1-88943-img0004.jpg)
Simple Western: MIS18A Antibody [NBP1-88943] - Simple Western lane view shows a specific band for MIS18A in 0.2 mg/ml of Ntera-2 (left) and h. Testis (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: MIS18A Antibody [NBP1-88943] - Electropherogram image of the corresponding Simple Western lane view. MIS18A antibody was used at 1:25 dilution on Ntera-2 and h. Testis lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5582_MIS18A-Antibody-Simple-Western-NBP1-88943-img0005.jpg)
Simple Western: MIS18A Antibody [NBP1-88943] - Electropherogram image of the corresponding Simple Western lane view. MIS18A antibody was used at 1:25 dilution on Ntera-2 and h. Testis lysate(s) respectively.