RASSF4 Antibody
| Name | RASSF4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89249 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RASSF4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RASSF4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RASSF4 Antibody [NBP1-89249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13980_RASSF4-Antibody-Western-Blot-NBP1-89249-img0004.jpg)
Western Blot: RASSF4 Antibody [NBP1-89249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: RASSF4 Antibody [NBP1-89249] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13981_RASSF4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89249-img0006.jpg)
Immunocytochemistry/Immunofluorescence: RASSF4 Antibody [NBP1-89249] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & cell junctions.
![Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human testis shows strong nuclear positivity in seminiferus tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13982_RASSF4-Antibody-Immunohistochemistry-Paraffin-NBP1-89249-img0001.jpg)
Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human testis shows strong nuclear positivity in seminiferus tubules.