TRIM23 Antibody
| Name | TRIM23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88846 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRIM23 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRIM23 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5945_TRIM23%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88846-img0003.jpg)
Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.
![Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human thyroid gland shows strong granular cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5946_TRIM23-Antibody-Immunohistochemistry-Paraffin-NBP1-88846-img0002.jpg)
Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human thyroid gland shows strong granular cytoplasmic and nuclear positivity in glandular cells.