FAM13A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-88825
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: FAM13A Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FAM13A
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: FAM13A Antibody [NBP1-88825] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & cell junctions.

Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.