SMPDL3B Antibody
| Name | SMPDL3B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88863 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTD |
| Blocking Peptide | SMPDL3B Protein |
| Description | Rabbit Polyclonal |
| Gene | SMPDL3B |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SMPDL3B Antibody [NBP1-88863] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25733_SMPDL3B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88863-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SMPDL3B Antibody [NBP1-88863] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & golgi apparatus.
![Immunohistochemistry-Paraffin: SMPDL3B Antibody [NBP1-88863] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25734_SMPDL3B%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88863-img0002.jpg)
Immunohistochemistry-Paraffin: SMPDL3B Antibody [NBP1-88863] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.