PM20D2 Antibody
| Name | PM20D2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89259 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKLQEEQFVN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PM20D2 Protein |
| Description | Rabbit Polyclonal |
| Gene | PM20D2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PM20D2 Antibody [NBP1-89259] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9633_PM20D2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89259-img0006.jpg)
Immunocytochemistry/Immunofluorescence: PM20D2 Antibody [NBP1-89259] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: PM20D2 Antibody [NBP1-89259] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells and decidua cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9634_PM20D2-Antibody-Immunohistochemistry-Paraffin-NBP1-89259-img0005.jpg)
Immunohistochemistry-Paraffin: PM20D2 Antibody [NBP1-89259] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells and decidua cells.