RBM6 Antibody
| Name | RBM6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89377 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RBM6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RBM6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RBM6 Antibody [NBP1-89377] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9918_RBM6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89377-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RBM6 Antibody [NBP1-89377] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies.
![Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89377] - Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9919_RBM6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89377-img0004.jpg)
Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89377] - Staining of human small intestine shows strong nuclear positivity in glandular cells.