BTBD8 Antibody
| Name | BTBD8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89429 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LYVKPCCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMAD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BTBD8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BTBD8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: BTBD8 Antibody [NBP1-89429] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8505_BTBD8%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89429-img0004.jpg)
Immunocytochemistry/Immunofluorescence: BTBD8 Antibody [NBP1-89429] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: BTBD8 Antibody [NBP1-89429] - Staining of human spleen shows distinct positivity in internal elastic lamina of blood vessel.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8506_BTBD8-Antibody-Immunohistochemistry-Paraffin-NBP1-89429-img0002.jpg)
Immunohistochemistry-Paraffin: BTBD8 Antibody [NBP1-89429] - Staining of human spleen shows distinct positivity in internal elastic lamina of blood vessel.