TARS Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-89427
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNIL
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: TARS Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: TARS
• Conjugate: Unconjugated

Product images

Western Blot: TARS Antibody [NBP1-89427] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG

Immunocytochemistry/Immunofluorescence: TARS Antibody [NBP1-89427] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.

Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Simple Western: TARS Antibody [NBP1-89427] - Simple Western lane view shows a specific band for TARS in 0.2 mg/ml of U-251 MG (left) and H. Pancreas (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: TARS Antibody [NBP1-89427] - Electropherogram image of the corresponding Simple Western lane view. TARS antibody was used at 1:25 dilution on U-251 MG and H. Pancreas lysate(s) respectively.