PF1 Antibody
| Name | PF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89599 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GGAVNMCYRTLYIGTGADMDVCLTNYGHCNYVSGKHACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAKVQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PHF12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PF1 Antibody [NBP1-89599] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9450_PF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89599-img0004.jpg)
![Immunohistochemistry-Paraffin: PF1 Antibody [NBP1-89599] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9451_PF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89599-img0002.jpg)