IL-20 R beta/FNDC6 Antibody
| Name | IL-20 R beta/FNDC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88020 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS |
| Description | Rabbit Polyclonal |
| Gene | IL20RB |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: FNDC6 Antibody [NBP1-88020] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25990_FNDC6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88020-img0004.jpg)
![Immunohistochemistry-Paraffin: FNDC6 Antibody [NBP1-88020] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25991_FNDC6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88020-img0002.jpg)