CNTD Antibody
| Name | CNTD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88064 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ELDVLKSLNFRINLPTPLAYVETLLEVLGYNGCLVPAMRLHATCLTLLDLVYLLHEPIYESLLRASIENSTPSQLQGEKFT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CNTD Protein |
| Description | Rabbit Polyclonal |
| Gene | CNTD1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CNTD Antibody [NBP1-88064] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25998_CNTD%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88064-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CNTD Antibody [NBP1-88064] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & plasma membrane.
![Immunohistochemistry-Paraffin: CNTD Antibody [NBP1-88064] - Staining of human rectum shows distinct nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/25999_CNTD%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88064-img0002.jpg)
Immunohistochemistry-Paraffin: CNTD Antibody [NBP1-88064] - Staining of human rectum shows distinct nuclear positivity in glandular cells.