SCGF beta Antibody

Name SCGF beta Antibody
Supplier Novus Biologicals
Catalog NBP1-88076
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:LYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Purity/Format Immunogen affinity purified
Blocking Peptide SCGF beta Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CLEC11A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.