RPUSD2 Antibody

Name RPUSD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-88438
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:SGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQRLSYNGQSSV
Purity/Format Immunogen affinity purified
Blocking Peptide RPUSD2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RPUSD2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.