DCUN1D2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-88397
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: DCUN1D2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: DCUN1D2
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: DCUN1D2 Antibody [NBP1-88397] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: DCUN1D2 Antibody [NBP1-88397] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Immunocytochemistry/Immunofluorescence: DCUN1D2 Antibody [NBP1-88397] - Staining of human cell line U-2 OS shows positivity in cytoplasm.