mediator of cell motility 1 Antibody

Name mediator of cell motility 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-88269
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK
Purity/Format Immunogen affinity purified
Blocking Peptide mediator of cell motility 1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene MEMO1
Conjugate Unconjugated
Supplier Page Shop

Product images