MRTO4 Antibody
| Name | MRTO4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88334 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MRTO4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MRTO4 |
| Supplier Page | Shop |
![Immunocytochemistry/ Immunofluorescence: MRTO4 Antibody [NBP1-88334] - Staining of human cell line A-431 shows positivity in nucleus & nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2765_MRTO4-Antibody-Immunocytochemistry--Immunofluorescence-NBP1-88334-img0004.jpg)
![Immunohistochemistry-Paraffin: MRTO4 Antibody [NBP1-88334] - Staining of human hippocampus shows distinct nucleolar positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2766_MRTO4-Antibody-Immunohistochemistry-Paraffin-NBP1-88334-img0005.jpg)