HES2 Antibody
| Name | HES2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88628 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GLILPLLGREDASGWHTWLPLHAQNCFLLYIQAPEQP |
| Blocking Peptide | HES2 Protein |
| Description | Rabbit Polyclonal |
| Gene | HES2 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: HES2 Antibody [NBP1-88628] - Staining of human cell line U-251 MG shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26257_HES2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88628-img0004.jpg)
![Immunohistochemistry-Paraffin: HES2 Antibody [NBP1-88628] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26258_HES2-Antibody-Immunohistochemistry-Paraffin-NBP1-88628-img0005.jpg)