Thyrotropin Releasing Hormone Antibody
| Name | Thyrotropin Releasing Hormone Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87427 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:REEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Thyrotropin Releasing Hormone Protein |
| Description | Rabbit Polyclonal |
| Gene | TRH |
| Supplier Page | Shop |
Product images
![Western Blot: Thyrotropin Releasing Hormone Antibody [NBP1-87427] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26312_Thyrotropin%2520Releasing%2520Hormone%2520Antibody-Western%2520Blot-NBP1-87427-img0004.jpg)
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP1-87427] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP1-87427] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26313_Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP1-87427-img0002.jpg)
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP1-87427] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.