C8orf79 Antibody
| Name | C8orf79 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87529 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GDRSTDNGLHRGAERSFCCALDPLPRRPPAGRRGRDRSSSACPGARAGVWPPGACASFRDSHKRFIMRRTALFHFTPTSFHLRYT |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KIAA1456 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C8orf79 Antibody [NBP1-87529] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26374_C8orf79%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87529-img0003.jpg)
Immunocytochemistry/Immunofluorescence: C8orf79 Antibody [NBP1-87529] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & plasma membrane.
![Immunohistochemistry-Paraffin: C8orf79 Antibody [NBP1-87529] - Staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26375_C8orf79%2520Antibody-Immunohistochemistry-Paraffin-NBP1-87529-img0002.jpg)
Immunohistochemistry-Paraffin: C8orf79 Antibody [NBP1-87529] - Staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.