CGI-128 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-88092
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:SMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: CGI-128 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FAM96B
• Conjugate: Unconjugated

Product images

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human testis shows moderate cytoplasmic positivity.

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.