FAM18B Antibody

Name FAM18B Antibody
Supplier Novus Biologicals
Catalog NBP1-88090
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Purity/Format Immunogen affinity purified
Blocking Peptide FAM18B Protein
Description Rabbit Polyclonal
Gene TVP23B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.