ethanolamine kinase Antibody
| Name | ethanolamine kinase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33292 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ethanolamine kinase Protein |
| Description | Rabbit Polyclonal |
| Gene | ETNK1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ethanolamine kinase Antibody [NBP2-33292] - Pancreatic cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26570_ethanolamine-kinase-Antibody-Immunohistochemistry-NBP2-33292-img0003.jpg)
Immunohistochemistry: ethanolamine kinase Antibody [NBP2-33292] - Pancreatic cancer
![Immunohistochemistry: ethanolamine kinase Antibody [NBP2-33292] - Immunohistochemical staining of human kidney shows cytoplasmic and nuclear positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26571_ethanolamine-kinase-Antibody-Immunohistochemistry-NBP2-33292-img0001.jpg)
Immunohistochemistry: ethanolamine kinase Antibody [NBP2-33292] - Immunohistochemical staining of human kidney shows cytoplasmic and nuclear positivity in cells in tubules.
![Immunohistochemistry: ethanolamine kinase Antibody [NBP2-33292] - Kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26572_ethanolamine-kinase-Antibody-Immunohistochemistry-NBP2-33292-img0002.jpg)
Immunohistochemistry: ethanolamine kinase Antibody [NBP2-33292] - Kidney