GIPC3 Antibody
| Name | GIPC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32591 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ELASTMVETSKKTASAQEFARCLDSVLGEFAF |
| Blocking Peptide | GIPC3 Protein |
| Description | Rabbit Polyclonal |
| Gene | GIPC3 |
| Supplier Page | Shop |
![Immunohistochemistry: GIPC3 Antibody [NBP2-32591] - Liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26593_GIPC3-Antibody-Immunohistochemistry-NBP2-32591-img0007.jpg)
![Immunohistochemistry: GIPC3 Antibody [NBP2-32591] - Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26594_GIPC3-Antibody-Immunohistochemistry-NBP2-32591-img0001.jpg)
![Immunohistochemistry: GIPC3 Antibody [NBP2-32591] - Pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26595_GIPC3-Antibody-Immunohistochemistry-NBP2-32591-img0002.jpg)