C2orf53 Antibody
| Name | C2orf53 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32417 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VVEYPICLVCLRPRSPSCPLPRYRTGPRLLAFPQLLPCVQGQESGPLR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C2orf53 Protein |
| Description | Rabbit Polyclonal |
| Gene | PRR30 |
| Supplier Page | Shop |
![Immunohistochemistry: C2orf53 Antibody [NBP2-32417] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26638_C2orf53%2520Antibody-Immunohistochemistry-NBP2-32417-img0006.jpg)
![Immunohistochemistry: C2orf53 Antibody [NBP2-32417] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26639_C2orf53-Antibody-Immunohistochemistry-NBP2-32417-img0001.jpg)
![Immunohistochemistry: C2orf53 Antibody [NBP2-32417] - placenta](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/26640_C2orf53-Antibody-Immunohistochemistry-NBP2-32417-img0002.jpg)