MAF1 Antibody
| Name | MAF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32389 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QTSGLSPSRLSKSQGGEEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MAF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MAF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MAF1 Antibody [NBP2-32389] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17339_MAF1-Antibody-Western-Blot-NBP2-32389-img0011.jpg)
Western Blot: MAF1 Antibody [NBP2-32389] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Tonsil tissue
![Immunocytochemistry/Immunofluorescence: MAF1 Antibody [NBP2-32389] - Immunofluorescent staining of human cell line A549 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17340_MAF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32389-img0015.jpg)
Immunocytochemistry/Immunofluorescence: MAF1 Antibody [NBP2-32389] - Immunofluorescent staining of human cell line A549 shows localization to nucleus.
![Immunohistochemistry-Paraffin: MAF1 Antibody [NBP2-32389] - Staining of human adrenal gland shows nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17341_MAF1-Antibody-Immunohistochemistry-Paraffin-NBP2-32389-img0014.jpg)
Immunohistochemistry-Paraffin: MAF1 Antibody [NBP2-32389] - Staining of human adrenal gland shows nuclear positivity in glandular cells.
![Simple Western: MAF1 Antibody [NBP2-32389] - Simple Western lane view shows a specific band for MAF1 in 0.2 mg/ml of H. Tonsil and MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17342_MAF1-Antibody-Simple-Western-NBP2-32389-img0008.jpg)
Simple Western: MAF1 Antibody [NBP2-32389] - Simple Western lane view shows a specific band for MAF1 in 0.2 mg/ml of H. Tonsil and MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.
![Simple Western: MAF1 Antibody [NBP2-32389] - Electropherogram image of the corresponding Simple Western lane view. MAF1 antibody was used at 1:25 dilution on H. Tonsil and MOLT-4 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17343_MAF1-Antibody-Simple-Western-NBP2-32389-img0009.jpg)
Simple Western: MAF1 Antibody [NBP2-32389] - Electropherogram image of the corresponding Simple Western lane view. MAF1 antibody was used at 1:25 dilution on H. Tonsil and MOLT-4 lysate(s) respectively.