Thyrotropin Releasing Hormone Antibody
| Name | Thyrotropin Releasing Hormone Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34014 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Thyrotropin Releasing Hormone Protein |
| Description | Rabbit Polyclonal |
| Gene | TRH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human hypothalamus shows strong positivity neuronal processes and subsets of neuronal cells and.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6644_Thyrotropin%2520Releasing%2520Hormone%2520Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0005.jpg)
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human hypothalamus shows strong positivity neuronal processes and subsets of neuronal cells and.